Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | DNAJC21 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19843220
![]() |
Novus Biologicals
NBP19843220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP198432
![]() |
Novus Biologicals
NBP198432 |
100 μL |
Each for $487.50
|
|
|||||
Description
DNAJC21 Polyclonal specifically detects DNAJC21 in Mouse samples. It is validated for Western Blot.Specifications
| DNAJC21 | |
| Polyclonal | |
| Rabbit | |
| NP_084322 | |
| 134218 | |
| The immunogen for this antibody is Dnajc21 - middle region. Peptide sequence FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DnaJ (Hsp40) homolog, subfamily C, member 21, DnaJ homolog subfamily A member 5, dnaJ homolog subfamily C member 21, DNAJA5DnaJ homology subfamily A member 5, GS3, JJJ1, JJJ1 DnaJ domain protein homolog, Protein GS3 | |
| DNAJC21 | |
| IgG | |
| 58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title