Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DNAJC21 Antibody, Novus Biologicals™

DNAJC21 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19843220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19843220 20 μL
NBP198432 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19843220 Supplier Novus Biologicals Supplier No. NBP19843220UL

Description

Rabbit Polyclonal Antibody

DNAJC21 Polyclonal specifically detects DNAJC21 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen DNAJC21
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_084322
Gene Alias DnaJ (Hsp40) homolog, subfamily C, member 21, DnaJ homolog subfamily A member 5, dnaJ homolog subfamily C member 21, DNAJA5DnaJ homology subfamily A member 5, GS3, JJJ1, JJJ1 DnaJ domain protein homolog, Protein GS3
Gene Symbols DNAJC21
Host Species Rabbit
Immunogen The immunogen for this antibody is Dnajc21 - middle region. Peptide sequence FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 134218
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.