ZFYVE21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198434

Catalog No. NBP198434

Description

ZFYVE21 Polyclonal specifically detects ZFYVE21 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZFYVE21
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FYVE domain containing 21, ZF21MGC2550, zinc finger FYVE domain-containing protein 21, zinc finger, FYVE domain containing 21
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 86%; Guinea pig: 86%; Bovine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_076976
• Gene Symbols: ZFYVE21
• Immunogen: The immunogen for this antibody is ZFYVE21 - middle region. Peptide sequence CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79038
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.