Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFYVE21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19843420UL
Description
ZFYVE21 Polyclonal specifically detects ZFYVE21 in Human samples. It is validated for Western Blot.Specifications
ZFYVE21 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_076976 | |
ZFYVE21 | |
The immunogen for this antibody is ZFYVE21 - middle region. Peptide sequence CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF. | |
Affinity Purified | |
RUO | |
79038 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FYVE domain containing 21, ZF21MGC2550, zinc finger FYVE domain-containing protein 21, zinc finger, FYVE domain containing 21 | |
Rabbit | |
26 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction