Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFYVE21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ZFYVE21 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19843420
![]() |
Novus Biologicals
NBP19843420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP198434
![]() |
Novus Biologicals
NBP198434 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZFYVE21 Polyclonal specifically detects ZFYVE21 in Human samples. It is validated for Western Blot.Specifications
ZFYVE21 | |
Polyclonal | |
Rabbit | |
NP_076976 | |
79038 | |
The immunogen for this antibody is ZFYVE21 - middle region. Peptide sequence CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FYVE domain containing 21, ZF21MGC2550, zinc finger FYVE domain-containing protein 21, zinc finger, FYVE domain containing 21 | |
ZFYVE21 | |
IgG | |
26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title