Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APJ/Apelin receptor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19846520UL
Description
APJ/Apelin receptor Polyclonal specifically detects APJ/Apelin receptor in Mouse samples. It is validated for Western Blot.Specifications
APJ/Apelin receptor | |
Polyclonal | |
Western Blot 1:1000 | |
NP_035914 | |
APLNR | |
The immunogen for this antibody is apelin receptor - C-terminal region. Peptide sequence CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ. | |
Affinity Purified | |
RUO | |
187 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AGTRL1HG11, angiotensin II receptor-like 1, Angiotensin receptor-like 1, apelin receptor, APJ (apelin) receptor, APJ receptor, APJFLJ96609, APJR, FLJ90771, G protein-coupled receptor APJ, G-protein coupled receptor APJ, G-protein coupled receptor HG11, HG11 orphan receptor, MGC45246 | |
Rabbit | |
42 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction