Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APJ/Apelin receptor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	APJ/Apelin receptor
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP19846520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19846520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP198465 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP198465	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

APJ/Apelin receptor Polyclonal specifically detects APJ/Apelin receptor in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	APJ/Apelin receptor
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_035914
Gene ID (Entrez)	187
Immunogen	The immunogen for this antibody is apelin receptor - C-terminal region. Peptide sequence CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	AGTRL1HG11, angiotensin II receptor-like 1, Angiotensin receptor-like 1, apelin receptor, APJ (apelin) receptor, APJ receptor, APJFLJ96609, APJR, FLJ90771, G protein-coupled receptor APJ, G-protein coupled receptor APJ, G-protein coupled receptor HG11, HG11 orphan receptor, MGC45246
Gene Symbols	APLNR
Isotype	IgG
Molecular Weight of Antigen	42 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

APJ/Apelin receptor Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents