Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APJ/Apelin receptor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | APJ/Apelin receptor |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19846520
|
Novus Biologicals
NBP19846520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198465
|
Novus Biologicals
NBP198465 |
100 μL |
Each for $499.50
|
|
|||||
Description
APJ/Apelin receptor Polyclonal specifically detects APJ/Apelin receptor in Mouse samples. It is validated for Western Blot.Specifications
| APJ/Apelin receptor | |
| Polyclonal | |
| Rabbit | |
| NP_035914 | |
| 187 | |
| The immunogen for this antibody is apelin receptor - C-terminal region. Peptide sequence CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AGTRL1HG11, angiotensin II receptor-like 1, Angiotensin receptor-like 1, apelin receptor, APJ (apelin) receptor, APJ receptor, APJFLJ96609, APJR, FLJ90771, G protein-coupled receptor APJ, G-protein coupled receptor APJ, G-protein coupled receptor HG11, HG11 orphan receptor, MGC45246 | |
| APLNR | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title