Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABLIM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19847220UL
Description
ABLIM1 Polyclonal specifically detects ABLIM1 in Mouse samples. It is validated for Western Blot.Specifications
ABLIM1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001096648 | |
ABLIM1 | |
The immunogen for this antibody is Ablim1 - middle region. Peptide sequence KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV. | |
Affinity Purified | |
RUO | |
3983 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, actin-binding double-zinc-finger protein, actin-binding LIM protein 1, Actin-binding LIM protein family member 1, DKFZp781D0148, FLJ14564, KIAA0059, LIM actin-binding protein 1, LIMAB1MGC1224, LIMATIN | |
Rabbit | |
62 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction