Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABLIM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ABLIM1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP19847220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19847220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP198472 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP198472	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ABLIM1 Polyclonal specifically detects ABLIM1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	ABLIM1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_001096648
Gene ID (Entrez)	3983
Immunogen	The immunogen for this antibody is Ablim1 - middle region. Peptide sequence KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, actin-binding double-zinc-finger protein, actin-binding LIM protein 1, Actin-binding LIM protein family member 1, DKFZp781D0148, FLJ14564, KIAA0059, LIM actin-binding protein 1, LIMAB1MGC1224, LIMATIN
Gene Symbols	ABLIM1
Isotype	IgG
Molecular Weight of Antigen	62 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ABLIM1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents