Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calmodulin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19847420UL
Description
Calmodulin 3 Polyclonal specifically detects Calmodulin 3 in Human samples. It is validated for Western Blot.Specifications
| Calmodulin 3 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| EAW57427 | |
| CALM3 | |
| The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CALM, CALM1, CALM2, CALML2, calmodulin, calmodulin 3 (phosphorylase kinase, delta), CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII, PHKD, PHKD3 | |
| Rabbit | |
| 12 kDa | |
| 20 μL | |
| Cancer | |
| 808 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction