Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calmodulin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Calmodulin 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19847420
|
Novus Biologicals
NBP19847420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198474
|
Novus Biologicals
NBP198474 |
100 μL |
Each for $487.50
|
|
|||||
Description
Calmodulin 3 Polyclonal specifically detects Calmodulin 3 in Human samples. It is validated for Western Blot.Specifications
| Calmodulin 3 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| CALM, CALM1, CALM2, CALML2, calmodulin, calmodulin 3 (phosphorylase kinase, delta), CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII, PHKD, PHKD3 | |
| CALM3 | |
| IgG | |
| 12 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EAW57427 | |
| 808 | |
| The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title