Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Calmodulin 3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen Calmodulin 3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP19847420
SDP
View Documents
Novus Biologicals
NBP19847420UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP198474
SDP
View Documents
Novus Biologicals
NBP198474
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

Calmodulin 3 Polyclonal specifically detects Calmodulin 3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Calmodulin 3
Polyclonal
Rabbit
Cancer
CALM, CALM1, CALM2, CALML2, calmodulin, calmodulin 3 (phosphorylase kinase, delta), CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII, PHKD, PHKD3
CALM3
IgG
12 kDa
Western Blot
Unconjugated
RUO
EAW57427
808
The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN.
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.