ETEA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198272

Catalog No. NBP198272

Description

ETEA Polyclonal specifically detects ETEA in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ETEA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B17.2L, ETEAFAS-associated factor 2, expressed in T-cells and eosinophils in atopic dermatitis, Fas associated factor family member 2, KIAA0887UBX domain protein 3B, MMTN, NDUNDUFA12L, UBX domain containing 8, UBX domain-containing protein 3B, UBX domain-containing protein 8, UBXD8, UBXN3BProtein ETEA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23197
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_848484
• Gene Symbols: FAF2
• Immunogen: The immunogen for this antibody is Faf2 antibody - N-terminal region. Peptide sequence LLQFQDLTGIESMEQCRLALEQHNWNMEAAVQDRLNEQEGVPSVFNPPPA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG