Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ETEA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	ETEA
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP198272 View Documents View Product Certificates	Novus Biologicals NBP198272	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ETEA Polyclonal specifically detects ETEA in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	ETEA
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_848484
Gene ID (Entrez)	23197
Immunogen	The immunogen for this antibody is Faf2 antibody - N-terminal region. Peptide sequence LLQFQDLTGIESMEQCRLALEQHNWNMEAAVQDRLNEQEGVPSVFNPPPA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	B17.2L, ETEAFAS-associated factor 2, expressed in T-cells and eosinophils in atopic dermatitis, Fas associated factor family member 2, KIAA0887UBX domain protein 3B, MMTN, NDUNDUFA12L, UBX domain containing 8, UBX domain-containing protein 3B, UBX domain-containing protein 8, UBXD8, UBXN3BProtein ETEA
Gene Symbols	FAF2
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ETEA Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents