Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

5033411D12Rik Antibody, Novus Biologicals™
SDP

Catalog No. NBP198273 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198273 100 μL
NBP19827320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP198273 Supplier Novus Biologicals Supplier No. NBP198273
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

5033411D12Rik Polyclonal specifically detects 5033411D12Rik in Mouse samples. It is validated for Western Blot.

Specifications

Antigen 5033411D12Rik
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7TNE1
Gene Symbols Sugct
Host Species Rabbit
Immunogen The immunogen for this antibody is 5033411D12Rik antibody - C-terminal region of mouse protein (NP_619595). Peptide sequence ANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKIL.
Molecular Weight of Antigen 48 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Test Specificity Canine 86%.
Reconstitution Centrifuge prior to reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.