Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RILP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP19827820UL
Description
RILP Polyclonal specifically detects RILP in Human samples. It is validated for Western Blot.Specifications
RILP | |
Polyclonal | |
Western Blot 1:1000 | |
NP_113618 | |
RILP | |
The immunogen for this antibody is RILP antibody - C-terminal region. Peptide sequence PPPPESKIQSFFGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDP. | |
Affinity Purified | |
RUO | |
83547 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
rab-interacting lysosomal protein, PP10141, Rab interacting lysosomal protein | |
Rabbit | |
44 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction