Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RILP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
$206.00 - $499.50
Specifications
| Antigen | RILP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19827820
|
Novus Biologicals
NBP19827820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198278
|
Novus Biologicals
NBP198278 |
100 μL |
Each for $499.50
|
|
|||||
Description
RILP Polyclonal specifically detects RILP in Human samples. It is validated for Western Blot.Specifications
| RILP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| rab-interacting lysosomal protein, PP10141, Rab interacting lysosomal protein | |
| RILP | |
| IgG | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_113618 | |
| 83547 | |
| The immunogen for this antibody is RILP antibody - C-terminal region. Peptide sequence PPPPESKIQSFFGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title