NOS1AP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198487

Catalog No. NBP198487

Description

NOS1AP Polyclonal specifically detects NOS1AP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOS1AP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 6330408P19Rik, CAPONMGC138500, carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain, nitric oxide synthase 1 (neuronal) adaptor protein, Nitric oxide synthase 1 adaptor protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 85%; Yeast: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: BAA32309
• Gene Symbols: NOS1AP
• Immunogen: The immunogen for this antibody is NOS1AP - C-terminal region. Peptide sequence PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9722
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.