Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOS1AP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | NOS1AP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19848720
|
Novus Biologicals
NBP19848720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198487
|
Novus Biologicals
NBP198487 |
100 μL |
Each for $487.50
|
|
|||||
Description
NOS1AP Polyclonal specifically detects NOS1AP in Human samples. It is validated for Western Blot.Specifications
| NOS1AP | |
| Polyclonal | |
| Rabbit | |
| BAA32309 | |
| 9722 | |
| The immunogen for this antibody is NOS1AP - C-terminal region. Peptide sequence PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 6330408P19Rik, CAPONMGC138500, carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain, nitric oxide synthase 1 (neuronal) adaptor protein, Nitric oxide synthase 1 adaptor protein | |
| NOS1AP | |
| IgG | |
| 63 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title