NOS1AP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19848720UL

Catalog No. NBP19848720

Description

NOS1AP Polyclonal specifically detects NOS1AP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOS1AP
• Classification: Polyclonal
• Dilution: Western Blot 1:1000
• Gene Accession No.: BAA32309
• Gene Symbols: NOS1AP
• Immunogen: The immunogen for this antibody is NOS1AP - C-terminal region. Peptide sequence PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9722
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 6330408P19Rik, CAPONMGC138500, carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain, nitric oxide synthase 1 (neuronal) adaptor protein, Nitric oxide synthase 1 adaptor protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG