Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$494.86
Specifications
| Antigen | ARL1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP198484
![]() |
Novus Biologicals
NBP198484 |
100 μL |
Each for $494.86
|
|
|||||
NBP19848420
![]() |
Novus Biologicals
NBP19848420UL |
20 μL | N/A | N/A | N/A | ||||
Description
ARL1 Polyclonal specifically detects ARL1 in Human samples. It is validated for Western Blot.Specifications
| ARL1 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P40616 | |
| 400 | |
| The immunogen for this antibody is ARL1 - C-terminal region (NP_001168). Peptide sequence: ILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEA | |
| Primary |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1 | |
| ARL1 | |
| IgG | |
| 20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title