Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARL1 Antibody, Novus Biologicals™

ARL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19848420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19848420 20 μL
NBP198484 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19848420 Supplier Novus Biologicals Supplier No. NBP19848420UL

Description

Rabbit Polyclonal Antibody

ARL1 Polyclonal specifically detects ARL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ARL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P40616
Gene Alias ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1
Gene Symbols ARL1
Host Species Rabbit
Immunogen The immunogen for this antibody is ARL1 - C-terminal region (NP_001168). Peptide sequence: ILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEA
Molecular Weight of Antigen 20 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 400
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.