Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19848420UL
Description
ARL1 Polyclonal specifically detects ARL1 in Human samples. It is validated for Western Blot.Specifications
ARL1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P40616 | |
ARL1 | |
The immunogen for this antibody is ARL1 - C-terminal region (NP_001168). Peptide sequence: ILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEA | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1 | |
Rabbit | |
20 kDa | |
20 μL | |
Signal Transduction | |
400 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction