Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRTAP3-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19850520UL
Description
KRTAP3-3 Polyclonal specifically detects KRTAP3-3 in Mouse samples. It is validated for Western Blot.Specifications
KRTAP3-3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_079800 | |
KRTAP3-3 | |
The immunogen for this antibody is Krtap3-3 - N-terminal region. Peptide sequence SVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQ. | |
Affinity Purified | |
RUO | |
85293 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
High sulfur keratin-associated protein 3.3, KAP3.3MGC95374, keratin associated protein 3-3, Keratin-associated protein 3.3, keratin-associated protein 3-3, KRTAP3.3 | |
Rabbit | |
10 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction