KRTAP3-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198505

Catalog No. NBP198505

Description

KRTAP3-3 Polyclonal specifically detects KRTAP3-3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: KRTAP3-3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: High sulfur keratin-associated protein 3.3, KAP3.3MGC95374, keratin associated protein 3-3, Keratin-associated protein 3.3, keratin-associated protein 3-3, KRTAP3.3
• Host Species: Rabbit
• Molecular Weight of Antigen: 10 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_079800
• Gene Symbols: KRTAP3-3
• Immunogen: The immunogen for this antibody is Krtap3-3 - N-terminal region. Peptide sequence SVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85293
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep
• Isotype: IgG