Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
INO80B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19850620UL
Description
INO80B Polyclonal specifically detects INO80B in Mouse samples. It is validated for Western Blot.Specifications
| INO80B | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_076036 | |
| INO80B | |
| The immunogen for this antibody is Ino80b - C-terminal region. Peptide sequence SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER. | |
| Affinity Purified | |
| RUO | |
| 83444 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HMGIYL4, IES2, IES2 homolog, INO80 complex subunit B, PAP-1 binding protein, PAP-1BP, PAPA1, zinc finger, HIT type 4 | |
| Rabbit | |
| 37 kDa | |
| 20 μL | |
| Primary | |
| Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction