Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
INO80B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$159.00 - $499.50
Specifications
| Antigen | INO80B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19850620
|
Novus Biologicals
NBP19850620UL |
20 μL |
Each for $159.00
|
|
|||||
|
NBP198506
|
Novus Biologicals
NBP198506 |
100 μL |
Each for $499.50
|
|
|||||
Description
INO80B Polyclonal specifically detects INO80B in Mouse samples. It is validated for Western Blot.Specifications
| INO80B | |
| Polyclonal | |
| Rabbit | |
| NP_076036 | |
| 83444 | |
| The immunogen for this antibody is Ino80b - C-terminal region. Peptide sequence SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HMGIYL4, IES2, IES2 homolog, INO80 complex subunit B, PAP-1 binding protein, PAP-1BP, PAPA1, zinc finger, HIT type 4 | |
| INO80B | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title