Cdc14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198508

Catalog No. NBP198508

Description

Cdc14A Polyclonal specifically detects Cdc14A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cdc14A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CDC10 (cell division cycle 10, S. cerevisiae, homolog), cdc14, CDC14 cell division cycle 14 homolog A, CDC14 cell division cycle 14 homolog A (S. cerevisiae), Cdc14A1, Cdc14A2, dual specificity protein phosphatase CDC14A, EC 3.1.3.16, EC 3.1.3.48, hCDC14
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 8556
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003663
• Gene Symbols: CDC14A
• Immunogen: The immunogen for this antibody is CDC14A - C-terminal region. Peptide sequence DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 87%; Mouse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG