Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cdc14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Cdc14A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP198508 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP198508	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

Cdc14A Polyclonal specifically detects Cdc14A in Human samples. It is validated for Western Blot.

Specifications

Antigen	Cdc14A
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	CDC10 (cell division cycle 10, S. cerevisiae, homolog), cdc14, CDC14 cell division cycle 14 homolog A, CDC14 cell division cycle 14 homolog A (S. cerevisiae), Cdc14A1, Cdc14A2, dual specificity protein phosphatase CDC14A, EC 3.1.3.16, EC 3.1.3.48, hCDC14
Gene Symbols	CDC14A
Isotype	IgG
Molecular Weight of Antigen	66 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_003663
Gene ID (Entrez)	8556
Immunogen	The immunogen for this antibody is CDC14A - C-terminal region. Peptide sequence DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Cdc14A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents