Rap2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198510

Catalog No. NBP198510

Description

Rap2B Polyclonal specifically detects Rap2B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Rap2B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC20484, RAP2B, member of RAS oncogene family, Ras family small GTP binding protein RAP2B, ras-related protein Rap-2b, small GTP binding protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5912
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002877
• Gene Symbols: RAP2B
• Immunogen: The immunogen for this antibody is RAP2B - C-terminal region. Peptide sequence YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Yeast: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG