Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Rap2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP198510 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198510 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP198510 Supplier Novus Biologicals Supplier No. NBP198510
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Rap2B Polyclonal specifically detects Rap2B in Human samples. It is validated for Western Blot.

Specifications

Antigen Rap2B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_002877
Gene Alias MGC20484, RAP2B, member of RAS oncogene family, Ras family small GTP binding protein RAP2B, ras-related protein Rap-2b, small GTP binding protein
Gene Symbols RAP2B
Host Species Rabbit
Immunogen The immunogen for this antibody is RAP2B - C-terminal region. Peptide sequence YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDE.
Molecular Weight of Antigen 20 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5912
Test Specificity Yeast: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.