Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE6C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PDE6C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PDE6C Polyclonal specifically detects PDE6C in Human samples. It is validated for Western Blot.Specifications
PDE6C | |
Polyclonal | |
Rabbit | |
Signal Transduction, Vision | |
NP_006195 | |
5146 | |
The immunogen for this antibody is PDE6C - C-terminal region. Peptide sequence LQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKAAEDSGGGDDKKSKT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
cGMP phosphodiesterase 6C, COD4, EC 3.1.4, EC 3.1.4.35, PDEA2cone cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha', phosphodiesterase 6C, cGMP-specific, cone, alpha prime | |
PDE6C | |
IgG | |
99 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title