IL-26/AK155 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198520

Catalog No. NBP198520

Description

IL-26/AK155 Polyclonal specifically detects IL-26/AK155 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IL-26/AK155
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AK155IL-26interleukin-26, interleukin 26, Protein AK155
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 55801
• Target Species: Human, Canine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_060872
• Gene Symbols: IL26
• Immunogen: The immunogen for this antibody is IL26 - N-terminal region. Peptide sequence: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.