Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-26/AK155 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | IL-26/AK155 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19852020
|
Novus Biologicals
NBP19852020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198520
|
Novus Biologicals
NBP198520 |
100 μL |
Each for $487.50
|
|
|||||
Description
IL-26/AK155 Polyclonal specifically detects IL-26/AK155 in Human samples. It is validated for Western Blot.Specifications
| IL-26/AK155 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| AK155IL-26interleukin-26, interleukin 26, Protein AK155 | |
| IL26 | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_060872 | |
| 55801 | |
| The immunogen for this antibody is IL26 - N-terminal region. Peptide sequence: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title