Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-26/AK155 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | IL-26/AK155 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19852020
![]() |
Novus Biologicals
NBP19852020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP198520
![]() |
Novus Biologicals
NBP198520 |
100 μL |
Each for $487.50
|
|
|||||
Description
IL-26/AK155 Polyclonal specifically detects IL-26/AK155 in Human samples. It is validated for Western Blot.Specifications
IL-26/AK155 | |
Polyclonal | |
Rabbit | |
Cytokine Research | |
AK155IL-26interleukin-26, interleukin 26, Protein AK155 | |
IL26 | |
IgG | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_060872 | |
55801 | |
The immunogen for this antibody is IL26 - N-terminal region. Peptide sequence: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title