Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NEIL2 Antibody, Novus Biologicals™

NEIL2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19852620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19852620 20 μL
NBP198526 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19852620 Supplier Novus Biologicals Supplier No. NBP19852620UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

NEIL2 Polyclonal specifically detects NEIL2 in Human samples. It is validated for Western Blot.

Specifications

Antigen NEIL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001129219
Gene Alias DNA glycosylase/AP lyase Neil2, EC 3.2.2.-, EC 4.2.99.18, endonuclease 8-like 2, Endonuclease VIII-like 2, FLJ31644, MGC2832, MGC4505, NEH2DNA-(apurinic or apyrimidinic site) lyase Neil2, nei endonuclease VIII-like 2 (E. coli), Nei homolog 2, nei like 2, nei like 2 (E. coli), NEI2, Nei-like protein 2
Gene Symbols NEIL2
Host Species Rabbit
Immunogen The immunogen for this antibody is NEIL2 - N-terminal region. Peptide sequence GDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGF.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Base Excision Repair, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 252969
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.