TCL1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198534

Catalog No. NBP198534

Description

TCL1B Polyclonal specifically detects TCL1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TCL1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Oncogene TCL1B, Oncogene TCL-1B, SYN-1, Syncytiotrophoblast-specific protein, T-cell leukemia/lymphoma 1B, T-cell leukemia/lymphoma protein 1B, T-cell lymphoma/leukemia 1B, TCL1, TCL1/MTCP1-like protein 1, TML1TCL1/ MTCP1-like 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 15 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 9623
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_004909
• Gene Symbols: TCL1B
• Immunogen: The immunogen for this antibody is TCL1B - N-terminal region. Peptide sequence NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.