Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCL1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TCL1B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TCL1B Polyclonal specifically detects TCL1B in Human samples. It is validated for Western Blot.Specifications
TCL1B | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
NP_004909 | |
9623 | |
The immunogen for this antibody is TCL1B - N-terminal region. Peptide sequence NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
Oncogene TCL1B, Oncogene TCL-1B, SYN-1, Syncytiotrophoblast-specific protein, T-cell leukemia/lymphoma 1B, T-cell leukemia/lymphoma protein 1B, T-cell lymphoma/leukemia 1B, TCL1, TCL1/MTCP1-like protein 1, TML1TCL1/ MTCP1-like 1 | |
TCL1B | |
IgG | |
15 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title