GNA14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198546

Catalog No. NBP198546

Description

GNA14 Polyclonal specifically detects GNA14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GNA14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G alpha-14, G-protein subunit alpha-14, guanine nucleotide binding protein (G protein), alpha 14, guanine nucleotide-binding protein 14, guanine nucleotide-binding protein subunit alpha-14
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 9630
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_004288
• Gene Symbols: GNA14
• Immunogen: The immunogen for this antibody is GNA14 - N-terminal region. Peptide sequence QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.