Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNA14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GNA14 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GNA14 Polyclonal specifically detects GNA14 in Human samples. It is validated for Western Blot.Specifications
GNA14 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Signal Transduction, Stem Cell Markers | |
G alpha-14, G-protein subunit alpha-14, guanine nucleotide binding protein (G protein), alpha 14, guanine nucleotide-binding protein 14, guanine nucleotide-binding protein subunit alpha-14 | |
GNA14 | |
IgG | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_004288 | |
9630 | |
The immunogen for this antibody is GNA14 - N-terminal region. Peptide sequence QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title