Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | MRFAP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19855220
![]() |
Novus Biologicals
NBP19855220UL |
20 μL |
Each for $204.00
|
|
|||||
NBP198552
![]() |
Novus Biologicals
NBP198552 |
100 μL |
Each for $482.50
|
|
|||||
Description
MRFAP1 Polyclonal specifically detects MRFAP1 in Human samples. It is validated for Western Blot.Specifications
MRFAP1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Mof4 family associated protein 1, Morf4 family associated protein 1, PAM14MORF4 family-associated protein 1, PGR1protein associated with MRG, 14 kDa, Protein associated with MRG of 14 kDa, Protein PGR1, T-cell activation protein | |
MRFAP1 | |
IgG | |
Affinity Purified | |
15 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_150638 | |
93621 | |
The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title