MRFAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198552

Catalog No. NBP198552

Description

MRFAP1 Polyclonal specifically detects MRFAP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRFAP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Mof4 family associated protein 1, Morf4 family associated protein 1, PAM14MORF4 family-associated protein 1, PGR1protein associated with MRG, 14 kDa, Protein associated with MRG of 14 kDa, Protein PGR1, T-cell activation protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 15 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_150638
• Gene Symbols: MRFAP1
• Immunogen: The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93621
• Target Species: Human, Pig, Bovine, Canine, Rabbit
• Isotype: IgG