Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198552
Description
MRFAP1 Polyclonal specifically detects MRFAP1 in Human samples. It is validated for Western Blot.Specifications
MRFAP1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_150638 | |
MRFAP1 | |
The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL. | |
Affinity Purified | |
RUO | |
93621 | |
Human, Porcine, Bovine, Canine, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Mof4 family associated protein 1, Morf4 family associated protein 1, PAM14MORF4 family-associated protein 1, PGR1protein associated with MRG, 14 kDa, Protein associated with MRG of 14 kDa, Protein PGR1, T-cell activation protein | |
Rabbit | |
15 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title