CCZ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198558

Catalog No. NBP198558

Description

CCZ1 Polyclonal specifically detects CCZ1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCZ1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C7orf28A, C7orf28B, CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae), CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae), CCZ1A, CGI-43, chromosome 7 open reading frame 28B, FLJ60592, H_DJ1163J12.2, H_NH0577018.2, MGC19819, vacuolar fusion protein CCZ1 homolog-like
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P86790
• Gene Symbols: CCZ1B
• Immunogen: The immunogen for this antibody is C7orf28B - C-terminal region. Peptide sequence NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221960
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.