Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCZ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198558
Description
CCZ1 Polyclonal specifically detects CCZ1 in Human samples. It is validated for Western Blot.Specifications
CCZ1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C7orf28A, C7orf28B, CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae), CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae), CCZ1A, CGI-43, chromosome 7 open reading frame 28B, FLJ60592, H_DJ1163J12.2, H_NH0577018.2, MGC19819, vacuolar fusion protein CCZ1 homolog-like | |
Rabbit | |
56 kDa | |
100 μL | |
Primary | |
Zebrafish: 79%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P86790 | |
CCZ1B | |
The immunogen for this antibody is C7orf28B - C-terminal region. Peptide sequence NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL. | |
Affinity purified | |
RUO | |
221960 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction