Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCZ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCZ1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCZ1 Polyclonal specifically detects CCZ1 in Human samples. It is validated for Western Blot.Specifications
CCZ1 | |
Polyclonal | |
Rabbit | |
P86790 | |
221960 | |
The immunogen for this antibody is C7orf28B - C-terminal region. Peptide sequence NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C7orf28A, C7orf28B, CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae), CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae), CCZ1A, CGI-43, chromosome 7 open reading frame 28B, FLJ60592, H_DJ1163J12.2, H_NH0577018.2, MGC19819, vacuolar fusion protein CCZ1 homolog-like | |
CCZ1B | |
IgG | |
56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title