Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP4R4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PPP4R4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP198567
|
Novus Biologicals
NBP198567 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19856720
|
Novus Biologicals
NBP19856720UL |
20 μL | N/A | N/A | N/A | ||||
Description
PPP4R4 Polyclonal specifically detects PPP4R4 in Mouse samples. It is validated for Western Blot.Specifications
| PPP4R4 | |
| Polyclonal | |
| Rabbit | |
| NP_083256 | |
| 57718 | |
| The immunogen for this antibody is Ppp4r4 - C-terminal region. Peptide sequence VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1622PP4R4HEAT-like repeat-containing protein, protein phosphatase 4, regulatory subunit 4, serine/threonine-protein phosphatase 4 regulatory subunit 4 | |
| PPP4R4 | |
| IgG | |
| 96 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title