Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYNPO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19829220UL
Description
SYNPO2 Polyclonal specifically detects SYNPO2 in Human samples. It is validated for Western Blot.Specifications
| SYNPO2 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_001122405 | |
| SYNPO2 | |
| The immunogen for this antibody is SYNPO2 - C-terminal region. Peptide sequence FTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFM. | |
| Affinity Purified | |
| RUO | |
| 171024 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| synaptopodin-2, synaptopodin 2 | |
| Rabbit | |
| 117 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction