Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYNPO2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$159.00 - $487.50
Specifications
| Antigen | SYNPO2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19829220
|
Novus Biologicals
NBP19829220UL |
20 μL |
Each for $159.00
|
|
|||||
|
NBP198292
|
Novus Biologicals
NBP198292 |
100 μL |
Each for $487.50
|
|
|||||
Description
SYNPO2 Polyclonal specifically detects SYNPO2 in Human samples. It is validated for Western Blot.Specifications
| SYNPO2 | |
| Polyclonal | |
| Rabbit | |
| NP_001122405 | |
| 171024 | |
| The immunogen for this antibody is SYNPO2 - C-terminal region. Peptide sequence FTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| synaptopodin-2, synaptopodin 2 | |
| SYNPO2 | |
| IgG | |
| 117 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title