Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TDRD7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TDRD7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19858520
|
Novus Biologicals
NBP19858520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198585
|
Novus Biologicals
NBP198585 |
100 μL |
Each for $487.50
|
|
|||||
Description
TDRD7 Polyclonal specifically detects TDRD7 in Rat samples. It is validated for Western Blot.Specifications
| TDRD7 | |
| Polyclonal | |
| Rabbit | |
| NP_620226 | |
| 23424 | |
| The immunogen for this antibody is Tdrd7 - C-terminal region. Peptide sequence CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1529, PCTAIRE2-binding protein, PCTAIRE2BPTRAP, RP11-508D10.1, Trap, tudor domain containing 7, tudor domain-containing protein 7, Tudor repeat associator with PCTAIRE 2 | |
| TDRD7 | |
| IgG | |
| 122 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title