Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ribosomal protein S27 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19859820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19859820 20 μL
NBP198598 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19859820 Supplier Novus Biologicals Supplier No. NBP19859820UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

Ribosomal protein S27 Polyclonal specifically detects Ribosomal protein S27 in Human samples. It is validated for Western Blot.

Specifications

Antigen Ribosomal protein S27
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001021
Gene Alias Metallopan-stimulin 1, MPS140S ribosomal protein S27, MPS-1metallopanstimulin 1, ribosomal protein S27, ribosomal protein S27 (metallopanstimulin 1)
Gene Symbols RPS27
Host Species Rabbit
Immunogen The immunogen for this antibody is Ribosomal protein S27 - N-terminal region. Peptide sequence DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL.
Molecular Weight of Antigen 9 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6232
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.