Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNA11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19860620UL
Description
GNA11 Polyclonal specifically detects GNA11 in Human, Mouse samples. It is validated for Western Blot.Specifications
| GNA11 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_002058 | |
| GNA11 | |
| The immunogen for this antibody is GNA11 - C-terminal region. Peptide sequence PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES. | |
| Affinity Purified | |
| RUO | |
| 2767 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11 | |
| Rabbit | |
| 41 kDa | |
| 20 μL | |
| Primary | |
| Human, Amphibian | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction