Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNA11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$493.10
Specifications
| Antigen | GNA11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP198606
|
Novus Biologicals
NBP198606 |
100 μL |
Each for $493.10
|
|
|||||
|
NBP19860620
|
Novus Biologicals
NBP19860620UL |
20 μL | N/A | N/A | N/A | ||||
Description
GNA11 Polyclonal specifically detects GNA11 in Human, Mouse samples. It is validated for Western Blot.Specifications
| GNA11 | |
| Polyclonal | |
| Rabbit | |
| NP_002058 | |
| 2767 | |
| The immunogen for this antibody is GNA11 - C-terminal region. Peptide sequence PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11 | |
| GNA11 | |
| IgG | |
| 41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title