Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198307
Description
CKS1 Polyclonal specifically detects CKS1 in Mouse samples. It is validated for Western Blot.Specifications
CKS1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CDC28 protein kinase 1, CDC28 protein kinase 1B, CDC28 protein kinase regulatory subunit 1B, cell division control protein CKS1, CKS-1, CKS1CDC2-associated protein CKS1, ckshs1, cyclin-dependent kinases regulatory subunit 1, NB4 apoptosis/differentiation related protein, PNAS-143, PNAS-16, PNAS-18 | |
Rabbit | |
10 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_058600 | |
CKS1B | |
The immunogen for this antibody is Cks1 - N-terminal region. Peptide sequence EFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH. | |
Affinity purified | |
RUO | |
1163 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction