Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | CKS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP198307
|
Novus Biologicals
NBP198307 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19830720
|
Novus Biologicals
NBP19830720UL |
20 μL | N/A | N/A | N/A | ||||
Description
CKS1 Polyclonal specifically detects CKS1 in Mouse samples. It is validated for Western Blot.Specifications
| CKS1 | |
| Polyclonal | |
| Rabbit | |
| NP_058600 | |
| 1163 | |
| The immunogen for this antibody is Cks1 - N-terminal region. Peptide sequence EFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CDC28 protein kinase 1, CDC28 protein kinase 1B, CDC28 protein kinase regulatory subunit 1B, cell division control protein CKS1, CKS-1, CKS1CDC2-associated protein CKS1, ckshs1, cyclin-dependent kinases regulatory subunit 1, NB4 apoptosis/differentiation related protein, PNAS-143, PNAS-16, PNAS-18 | |
| CKS1B | |
| IgG | |
| 10 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title