Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM207A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM207A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM207A Polyclonal specifically detects FAM207A in Human samples. It is validated for Western Blot.Specifications
FAM207A | |
Polyclonal | |
Rabbit | |
NP_478070 | |
85395 | |
The immunogen for this antibody is FAM207A - N-terminal region. Peptide sequence AAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSAL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 21 open reading frame 70, hypothetical protein LOC85395, PRED56 | |
FAM207A | |
IgG | |
25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title